PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G124400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 382aa    MW: 42795.2 Da    PI: 6.7784
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G124400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.6e-52141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         l pGfrFhPtdeelv +yLk+k+++k+l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++
  Brast05G124400.1.p  14 LLPGFRFHPTDEELVGFYLKRKIQQKPLSI-ELIRQLDIYKYDPWDLPKLASSGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP 103
                         579***************************.89***************8888999************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  Brast05G124400.1.p 104 IYSSeGTKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 141
                         ***956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5810172IPR003441NAC domain
PROSITE profilePS5100557.04614172IPR003441NAC domain
PfamPF023651.0E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDERCDMDKS EEVLLPGFRF HPTDEELVGF YLKRKIQQKP LSIELIRQLD IYKYDPWDLP  60
KLASSGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGT KCIGLKKSLV  120
FYKGRAAKGI KTDWMMHEFR LPSLTDPSVP KIPIDKNIPA NDAWAICRIF KKPSSMAQRA  180
LSHSWGPQST AMTEPDLLSA LQSIQASHFA LEGSSRSAEV ALPANRFNSQ QSFQGRQPQK  240
LSSSENGSSC KVINFNRSPS LTHLPDKDVH SGPIILPFET QTLQKSSDAT TVLLSIAPGI  300
INSINEASPN AELEQPEECN GYAVDWVMGT DKGIGNSDED PYTRKPENGY ITDNQCGVSR  360
KIKFPFDLGE DSSDDWNIFV P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-531417517168NAC domain-containing protein 19
4dul_A2e-531417517168NAC domain-containing protein 19
1ut7_B2e-531417517168NO APICAL MERISTEM PROTEIN
1ut7_A2e-531417517168NO APICAL MERISTEM PROTEIN
1ut4_B2e-531417517168NO APICAL MERISTEM PROTEIN
1ut4_A2e-531417517168NO APICAL MERISTEM PROTEIN
3swp_D2e-531417520171NAC domain-containing protein 19
3swp_C2e-531417520171NAC domain-containing protein 19
3swp_B2e-531417520171NAC domain-containing protein 19
3swp_A2e-531417520171NAC domain-containing protein 19
3swm_D2e-531417520171NAC domain-containing protein 19
3swm_C2e-531417520171NAC domain-containing protein 19
3swm_B2e-531417520171NAC domain-containing protein 19
3swm_A2e-531417520171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956807.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-100FEZ_ARATH; Protein FEZ
TrEMBLA0A0Q3IW030.0A0A0Q3IW03_BRADI; Uncharacterized protein
STRINGBRADI4G30177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-101NAC family protein